PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000291518
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 356aa    MW: 40802.6 Da    PI: 9.4967
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000291518genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.8e-181560147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G  +W++Ia++++ gR++k+c++rw++ 
    MDP0000291518 15 RGHWRPAEDEKLRQLVEQYGAQNWNSIAEKLQ-GRSGKSCRLRWFNQ 60
                     899*****************************.***********996 PP

2Myb_DNA-binding58.71.3e-1867110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ 
    MDP0000291518  67 RRPFSEEEEERLLAAHRIHGNK-WALIARLFP-GRTDNAVKNHWHV 110
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.6341061IPR017930Myb domain
SuperFamilySSF466891.54E-2913108IPR009057Homeodomain-like
SMARTSM007178.4E-151463IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-271668IPR009057Homeodomain-like
CDDcd001675.64E-141859No hitNo description
PfamPF139217.7E-181878No hitNo description
PROSITE profilePS5129427.38462116IPR017930Myb domain
SMARTSM007174.9E-1666114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2169114IPR009057Homeodomain-like
CDDcd001671.02E-778109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MEDYGDEAKS TSCPRGHWRP AEDEKLRQLV EQYGAQNWNS IAEKLQGRSG KSCRLRWFNQ  60
LDPKINRRPF SEEEEERLLA AHRIHGNKWA LIARLFPGRT DNAVKNHWHV IMARRQREQS  120
KVCGKRSFQD FCNDHSPNTS SFSNNFDASG RLRSQGSSIG FDQNNISTKF FEFXNPNKDR  180
AMFMDSRPTS SSPYNWNFAS MSATSNNSSS SVDLLGRERR DYFNNGSSNY TITEFSKGLH  240
PQFVHRRHNP SSSFLYGRYR GSSSNAFGRP TNNRVNVPSP FGCLNPADYH INRHDQHGST  300
FKIGLANLYE NASTLQKWRV AATTTKFDDH DPQDHESIDH NKETPFIDFL GVGISS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31151157107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008381717.10.0PREDICTED: transcription factor LAF1-like
TrEMBLM5VN750.0M5VN75_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s20870.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-61myb domain protein 52